PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr025199.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 324aa    MW: 34846.2 Da    PI: 8.601
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr025199.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.6e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l ++v+++G+++W++I++ ++ gR++k+c++rw + 
      Pbr025199.1 12 KGPWSPEEDDSLQKLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding55.51.3e-1766108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar ++ gRt++ +k++w++ 
      Pbr025199.1  66 AFTPEEDDTIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 108
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.661762IPR017930Myb domain
SuperFamilySSF466895.24E-329105IPR009057Homeodomain-like
SMARTSM007171.5E-161160IPR001005SANT/Myb domain
PfamPF002494.4E-191257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-261365IPR009057Homeodomain-like
CDDcd001678.05E-161456No hitNo description
SMARTSM007179.2E-1563111IPR001005SANT/Myb domain
PROSITE profilePS5129420.99664113IPR017930Myb domain
CDDcd001674.93E-1266109No hitNo description
PfamPF002492.3E-1566108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2366112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MAVIRKDMDR IKGPWSPEED DSLQKLVQKH GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
QVEHRAFTPE EDDTIIRAHA RFGNKWATIA RLLNGRTDNA IKNHWNSTLK RKCSDGGGVV  120
LNGGYDGHFL LDHEQPPLKR SVSAGSGVPV STGLYMSPGS PSGSDVSDSS VQVMSLPDCH  180
VYRPVARSGG VLPPVETTSS SNNSSNSEKE NDPPTSLSLS LPGVDAGEVS NRVAAATESI  240
PAPIPAAPVL NMPSELLGVM QGMIRKEVRS YMARLEQGGV CFQQAAAADN DGFRNVGVNR  300
IGFIAGLSEG ERCGVFRTFS QLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-42111123104C-Myb DNA-Binding Domain
1mse_C2e-42111123104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4039580.0JX403958.1 Pyrus communis R2R3 MYB transcription factor 2 (MYB2) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009367649.10.0PREDICTED: transcription factor MYB44
SwissprotQ9FDW13e-94MYB44_ARATH; Transcription factor MYB44
TrEMBLD9ZJ610.0D9ZJ61_MALDO; MYB domain class transcription factor
STRINGPOPTR_0007s10490.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-90myb domain protein 73